PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn307721
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 190aa    MW: 21228.6 Da    PI: 4.6127
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn307721genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding292.4e-09138180145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ ++++E+ l+ +  ++ G + W++Ia +++ gR+++++  +w 
       Achn307721 138 KLEFSEDEETLITRMYNLVGER-WSLIAGRIP-GRSAEEIEKYWT 180
                      678*******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.780.103.5E-301488IPR001950Translation initiation factor SUI1
SuperFamilySSF551592.09E-191787IPR001950Translation initiation factor SUI1
PfamPF012537.7E-163584IPR001950Translation initiation factor SUI1
CDDcd115661.72E-303688No hitNo description
PROSITE profilePS5029616.2853889IPR001950Translation initiation factor SUI1
PROSITE profilePS500907.097133183IPR017877Myb-like domain
SMARTSM007175.6E-8137185IPR001005SANT/Myb domain
PfamPF002494.3E-8139180IPR001005SANT/Myb domain
SuperFamilySSF466891.06E-7140183IPR009057Homeodomain-like
CDDcd001677.14E-8140179No hitNo description
Gene3DG3DSA:1.10.10.601.9E-11140181IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006413Biological Processtranslational initiation
GO:0003677Molecular FunctionDNA binding
GO:0003743Molecular Functiontranslation initiation factor activity
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MKEGELSIAF NCAISLPNLD PFAEASTEDS GAGTKEYVHV RTQQRNGRKS LTTVQGLKKE  60
FSYNKILKDL KKEFCCNGTV VQDPELGQQP PMPPPTNSFF LASFNSCLFS TIMADLEQYS  120
SSDNASVDSR EYSSQDSKLE FSEDEETLIT RMYNLVGERW SLIAGRIPGR SAEEIEKYWT  180
SRYSTSEGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ogh_A5e-231588576Eukaryotic translation initiation factor eIF-
3j80_j5e-231588576eIF1
3j81_m5e-231588576eIF1
3jam_j5e-231588576eIF1
3jap_m5e-231588576eIF1
3jaq_m5e-231588576eIF1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM1C8628e-68M1C862_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000618642e-67(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA65791932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.11e-17MYB_related family protein